FBXL18 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXL18 Antibody [NBP2-54920] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXL18 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLAFMARCLQVVMCHLFTGES
Specificity
Specificity of human FBXL18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL18
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXL18 Recombinant Protein Antigen (NBP2-54920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FBXL18 Antibody

  • Fbl18
  • F-box and leucine-rich repeat protein 18FLJ38075
  • F-box/LRR-repeat protein 18
  • FLJ10776
  • FLJ11467
  • FLJ26934
  • FLJ41541

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1289
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29923
Species: Hu
Applications: WB, Flow
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45693
Species: Hu
Applications: WB, IHC
NBP1-55045
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-83918
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for FBXL18 Antibody (NBP2-54920) (0)

There are no publications for FBXL18 Antibody (NBP2-54920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL18 Antibody (NBP2-54920) (0)

There are no reviews for FBXL18 Antibody (NBP2-54920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXL18 Antibody (NBP2-54920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FBXL18 Antibody (NBP2-54920)

Discover related pathways, diseases and genes to FBXL18 Antibody (NBP2-54920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL18 Antibody (NBP2-54920)

Discover more about diseases related to FBXL18 Antibody (NBP2-54920).

Blogs on FBXL18

There are no specific blogs for FBXL18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXL18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL18