FBX09 Antibody

Images

 
Western Blot: FBX09 Antibody [NBP2-57524] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: FBX09 Antibody [NBP2-57524] - Staining of human cell line SiHa shows localization to centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBX09 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQE
Specificity
Specificity of human FBX09 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBX09 Recombinant Protein Antigen (NBP2-57524PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FBX09 Antibody

  • Cross-immune reaction antigen 1
  • dJ341E18.2
  • F-box only protein 9
  • F-box protein 9
  • F-box protein Fbx9
  • FBX9DKFZp434C0118
  • KIAA0936
  • NY-REN-57
  • Renal carcinoma antigen NY-REN-57
  • VCIA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP3-04614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27327
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-57524
Species: Hu
Applications: WB, ICC/IF

Publications for FBX09 Antibody (NBP2-57524) (0)

There are no publications for FBX09 Antibody (NBP2-57524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBX09 Antibody (NBP2-57524) (0)

There are no reviews for FBX09 Antibody (NBP2-57524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBX09 Antibody (NBP2-57524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBX09 Products

Bioinformatics Tool for FBX09 Antibody (NBP2-57524)

Discover related pathways, diseases and genes to FBX09 Antibody (NBP2-57524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBX09 Antibody (NBP2-57524)

Discover more about diseases related to FBX09 Antibody (NBP2-57524).
 

Pathways for FBX09 Antibody (NBP2-57524)

View related products by pathway.

Research Areas for FBX09 Antibody (NBP2-57524)

Find related products by research area.

Blogs on FBX09

There are no specific blogs for FBX09, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBX09 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO9