FATP5/SLC27A5 Antibody


Western Blot: SLC27A5 Antibody [NBP1-69674] - This Anti-SLC27A5 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related FATP5/SLC27A5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FATP5/SLC27A5 Antibody Summary

Synthetic peptides corresponding to SLC27A5(solute carrier family 27 (fatty acid transporter), member 5) The peptide sequence was selected from the middle region of SLC27A5. Peptide sequence KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC27A5 and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FATP5/SLC27A5 Antibody

  • ACSB
  • ACSVL6
  • BA-CoA ligase
  • Bile acid-CoA ligase
  • bile acyl-CoA synthetase
  • Cholate--CoA ligase
  • EC
  • FACVL3
  • FATP5
  • FATP5Solute carrier family 27 member 5
  • Fatty acid transport protein 5
  • Fatty-acid-coenzyme A ligase, very long-chain 3
  • FLJ22987
  • SLC27A5
  • solute carrier family 27 (fatty acid transporter), member 5
  • VLACSRVery long-chain acyl-CoA synthetase homolog 2
  • VLCSH2
  • VLCSH2Very long-chain acyl-CoA synthetase-related protein
  • VLCS-H2VLACS-related


The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for FATP5/SLC27A5 Antibody (NBP1-69674) (0)

There are no publications for FATP5/SLC27A5 Antibody (NBP1-69674).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP5/SLC27A5 Antibody (NBP1-69674) (0)

There are no reviews for FATP5/SLC27A5 Antibody (NBP1-69674). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FATP5/SLC27A5 Antibody (NBP1-69674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FATP5/SLC27A5 Products

Bioinformatics Tool for FATP5/SLC27A5 Antibody (NBP1-69674)

Discover related pathways, diseases and genes to FATP5/SLC27A5 Antibody (NBP1-69674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FATP5/SLC27A5 Antibody (NBP1-69674)

Discover more about diseases related to FATP5/SLC27A5 Antibody (NBP1-69674).

Pathways for FATP5/SLC27A5 Antibody (NBP1-69674)

View related products by pathway.

PTMs for FATP5/SLC27A5 Antibody (NBP1-69674)

Learn more about PTMs related to FATP5/SLC27A5 Antibody (NBP1-69674).

Blogs on FATP5/SLC27A5

There are no specific blogs for FATP5/SLC27A5, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FATP5/SLC27A5 Antibody and receive a gift card or discount.


Gene Symbol SLC27A5