Fas Ligand/TNFSF6 Antibody (2G9-G8)

Images

 
Western Blot: Fas Ligand/TNFSF6 Antibody (2G9-G8) [H00000356-M02] - Analysis of FASLG expression in transfected 293T cell line by FASLG monoclonal antibody (M02), clone 2G9-G8.Lane 1: FASLG transfected lysate (Predicted ...read more
Immunocytochemistry/ Immunofluorescence: Fas Ligand/TNFSF6 Antibody (2G9-G8) [H00000356-M02] - Analysis of monoclonal antibody to TNFSF6 on HeLa cell. Antibody concentration 10 ug/ml.
Proximity Ligation Assay: Fas Ligand/TNFSF6 Antibody (2G9-G8) [H00000356-M02] - Analysis of protein-protein interactions between MMP7 and FASLG. HeLa cells were stained with anti-MMP7 rabbit purified polyclonal 1:1200 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
2G9-G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fas Ligand/TNFSF6 Antibody (2G9-G8) Summary

Immunogen
FASLG (AAH17502.1, 1 a.a. - 281 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Specificity
FASLG - Fas ligand (TNF superfamily, member 6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FASLG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fas Ligand/TNFSF6 Antibody (2G9-G8)

  • apoptosis (APO-1) antigen ligand 1
  • Apoptosis antigen ligand
  • APT1LG1CD95L
  • APTL
  • CD178 antigen
  • CD178
  • CD95L
  • CD95-L
  • Fas antigen ligand
  • Fas ligand (TNF superfamily, member 6)
  • Fas Ligand
  • FASLCD95 ligand
  • FASLG
  • TNFSF6
  • TNFSF6FasL
  • tumor necrosis factor (ligand) superfamily, member 6
  • tumor necrosis factor ligand superfamily member 6

Background

The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000356-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for Fas Ligand/TNFSF6 Antibody (H00000356-M02) (0)

There are no publications for Fas Ligand/TNFSF6 Antibody (H00000356-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fas Ligand/TNFSF6 Antibody (H00000356-M02) (0)

There are no reviews for Fas Ligand/TNFSF6 Antibody (H00000356-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fas Ligand/TNFSF6 Antibody (H00000356-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fas Ligand/TNFSF6 Products

Bioinformatics Tool for Fas Ligand/TNFSF6 Antibody (H00000356-M02)

Discover related pathways, diseases and genes to Fas Ligand/TNFSF6 Antibody (H00000356-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fas Ligand/TNFSF6 Antibody (H00000356-M02)

Discover more about diseases related to Fas Ligand/TNFSF6 Antibody (H00000356-M02).
 

Pathways for Fas Ligand/TNFSF6 Antibody (H00000356-M02)

View related products by pathway.

PTMs for Fas Ligand/TNFSF6 Antibody (H00000356-M02)

Learn more about PTMs related to Fas Ligand/TNFSF6 Antibody (H00000356-M02).
 

Research Areas for Fas Ligand/TNFSF6 Antibody (H00000356-M02)

Find related products by research area.

Blogs on Fas Ligand/TNFSF6

There are no specific blogs for Fas Ligand/TNFSF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fas Ligand/TNFSF6 Antibody (2G9-G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol FASLG
Entrez
OMIM
Uniprot