FANK1 Antibody

Images

 
Western Blot: FANK1 Antibody [NBP2-32686] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry: FANK1 Antibody [NBP2-32686] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FANK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FANK1 Protein (NBP2-32686PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FANK1 Antibody

  • 1700007B22Rik
  • fibronectin type 3 and ankyrin repeat domains 1
  • fibronectin type 3 and ankyrin repeat domains protein 1
  • fibronectin type III and ankyrin repeat domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82890
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-02374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41292
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1031
Species: Hu
Applications: WB, IP, ICC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-88402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for FANK1 Antibody (NBP2-32686) (0)

There are no publications for FANK1 Antibody (NBP2-32686).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANK1 Antibody (NBP2-32686) (0)

There are no reviews for FANK1 Antibody (NBP2-32686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANK1 Antibody (NBP2-32686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FANK1 Products

Bioinformatics Tool for FANK1 Antibody (NBP2-32686)

Discover related pathways, diseases and genes to FANK1 Antibody (NBP2-32686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANK1 Antibody (NBP2-32686)

Discover more about diseases related to FANK1 Antibody (NBP2-32686).
 

Pathways for FANK1 Antibody (NBP2-32686)

View related products by pathway.

Blogs on FANK1

There are no specific blogs for FANK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANK1