FANCC Recombinant Protein Antigen

Images

 
There are currently no images for FANCC Recombinant Protein Antigen (NBP2-55256PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FANCC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to FANCC.

Source: E. coli

Amino Acid Sequence: NSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FANCC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55256.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FANCC Recombinant Protein Antigen

  • FA Complementation Group C
  • FA3
  • FACC
  • FACCProtein FACC
  • FACFanconi anemia group C protein
  • FANCC
  • Fanconi anemia, complementation group C
  • FLJ14675

Background

The Fanconi anemia group C protein (FANCC) is a member of the Fanconi anemia complementation. FANCC functions as a cell cycle checkpoint to delay the onset of apoptosis and promotes homologous recombination repair of damaged DNA. FANCC may be important for the maintenance of chromosome stability and reparation of interstrand DNA cross linkages. Defects in FANCC portein result in a disease state, Fanconi anemia, an autosomal recessive disorder. Fanconi anemia results in many congenital malformations and predisposition to malignant formations.

FANCC antibodies are useful for DNA repair studies and cell cycle research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2564
Species: Hu
Applications: WB
NB100-2566
Species: Hu
Applications: IB, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00002188-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-49878
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-48736
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-52406
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
3944-ED
Species: Hu
Applications: Bind

Publications for FANCC Recombinant Protein Antigen (NBP2-55256PEP) (0)

There are no publications for FANCC Recombinant Protein Antigen (NBP2-55256PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCC Recombinant Protein Antigen (NBP2-55256PEP) (0)

There are no reviews for FANCC Recombinant Protein Antigen (NBP2-55256PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FANCC Recombinant Protein Antigen (NBP2-55256PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCC Products

Research Areas for FANCC Recombinant Protein Antigen (NBP2-55256PEP)

Find related products by research area.

Blogs on FANCC.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FANCC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCC