FAM91A1 Antibody


Immunocytochemistry/ Immunofluorescence: FAM91A1 Antibody [NBP1-83576] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: FAM91A1 Antibody [NBP1-83576] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FAM91A1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LHGIGETVHVPFPFDETELQGEFTRVNMGVHKALQILRNRVDLQHLCGYVTMLNASSQLADRKLSDASDERGEPDLASGS
Specificity of human FAM91A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM91A1 Protein (NBP1-83576PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM91A1 Antibody

  • DKFZp666B104
  • family with sequence similarity 91, member A1
  • FLJ23790
  • hypothetical protein LOC157769
  • skeletal muscle cells re-entry induced


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM91A1 Antibody (NBP1-83576) (0)

There are no publications for FAM91A1 Antibody (NBP1-83576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM91A1 Antibody (NBP1-83576) (0)

There are no reviews for FAM91A1 Antibody (NBP1-83576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM91A1 Antibody (NBP1-83576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM91A1 Products

FAM91A1 NBP1-83576

Bioinformatics Tool for FAM91A1 Antibody (NBP1-83576)

Discover related pathways, diseases and genes to FAM91A1 Antibody (NBP1-83576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM91A1

There are no specific blogs for FAM91A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM91A1 Antibody and receive a gift card or discount.


Gene Symbol FAM91A1