FAM58A Antibody

Images

 
Western Blot: FAM58A Antibody [NBP3-10183] - Western blot analysis of FAM58A in Mouse Pancreas lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM58A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse FAM58A (NP_932106.1). Peptide sequence LAGKVEEQHLRTRDIINVSHRYFNPGSEPLELDSRFWELRDSIVQCELLM
Clonality
Polyclonal
Host
Rabbit
Gene
CCNQ, FAM58A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM58A Antibody

  • cyclin M
  • Cyclin-M
  • cyclin-related protein FAM58A
  • family with sequence similarity 58, member A
  • MGC29729
  • STAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-20029
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-78644
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
236-EG
Species: Hu
Applications: BA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84773
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP3-10183
Species: Mu
Applications: WB

Publications for FAM58A Antibody (NBP3-10183) (0)

There are no publications for FAM58A Antibody (NBP3-10183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM58A Antibody (NBP3-10183) (0)

There are no reviews for FAM58A Antibody (NBP3-10183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM58A Antibody (NBP3-10183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM58A Products

Bioinformatics Tool for FAM58A Antibody (NBP3-10183)

Discover related pathways, diseases and genes to FAM58A Antibody (NBP3-10183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM58A Antibody (NBP3-10183)

Discover more about diseases related to FAM58A Antibody (NBP3-10183).

Blogs on FAM58A

There are no specific blogs for FAM58A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM58A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNQ, FAM58A