Novus Biologicals products are now on bio-techne.com

FAM36A Antibody

Images

 
Western Blot: FAM36A Antibody [NBP2-87418] - Host: Rabbit. Target Name: FAM36A. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

FAM36A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human FAM36A. Peptide sequence: VTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
COX20
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for FAM36A Antibody

  • family with sequence similarity 36, member A
  • FLJ43269

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2134
Species: Hu, Mu
Applications: IHC, IHC-P, IP (-), IP, Simple Western, WB
NBP1-47657
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-82381
Species: Hu
Applications: WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00285521-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-81219
Species: Hu
Applications: IHC, IHC-P, WB
AF3470
Species: Hu
Applications: ICC, WB
G-125-C
Species: Hu
Applications:
NBP2-32276
Species: Hu
Applications: IP, WB
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-81634
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6898
Species: Hu, Mu
Applications: WB
H00118490-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87073
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-87418
Species: Hu
Applications: WB

Publications for FAM36A Antibody (NBP2-87418) (0)

There are no publications for FAM36A Antibody (NBP2-87418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM36A Antibody (NBP2-87418) (0)

There are no reviews for FAM36A Antibody (NBP2-87418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM36A Antibody (NBP2-87418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM36A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX20