FAM204A Antibody


Immunocytochemistry/ Immunofluorescence: FAM204A Antibody [NBP2-56149] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

FAM204A Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQL
Specificity of human FAM204A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM204A Recombinant Protein Antigen (NBP2-56149PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FAM204A Antibody

  • bA319I23.1
  • chromosome 10 open reading frame 84
  • FLJ13188
  • hypothetical protein LOC63877


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM204A Antibody (NBP2-56149) (0)

There are no publications for FAM204A Antibody (NBP2-56149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM204A Antibody (NBP2-56149) (0)

There are no reviews for FAM204A Antibody (NBP2-56149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM204A Antibody (NBP2-56149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FAM204A Antibody (NBP2-56149)

Discover related pathways, diseases and genes to FAM204A Antibody (NBP2-56149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM204A

There are no specific blogs for FAM204A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM204A Antibody and receive a gift card or discount.


Gene Symbol FAM204A