FAM169B Antibody


Immunohistochemistry: FAM169B Antibody [NBP2-31621] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Product Discontinued
View other related FAM169B Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FAM169B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RGLGTAMLRDFCETFPEDEALGVSCPMSPAMYQAHPGNSEDVSRHARTSQNDRPRQPAPGDGSKERMCGEELEDTKDDPEC
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM169B Antibody

  • family with sequence similarity 169, member B
  • FLJ39743
  • hypothetical protein LOC283777
  • KIAA0888L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM169B Antibody (NBP2-31621) (0)

There are no publications for FAM169B Antibody (NBP2-31621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM169B Antibody (NBP2-31621) (0)

There are no reviews for FAM169B Antibody (NBP2-31621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM169B Antibody (NBP2-31621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP2-31621

Bioinformatics Tool for FAM169B Antibody (NBP2-31621)

Discover related pathways, diseases and genes to FAM169B Antibody (NBP2-31621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM169B

There are no specific blogs for FAM169B, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM169B Antibody and receive a gift card or discount.


Gene Symbol FAM169B