FAM108A1 Antibody


Western Blot: FAM108A1 Antibody [NBP3-10857] - Western blot analysis of FAM108A1 in Rat Thymus lysates. Antibody dilution at 1ug/ml

Product Details

Reactivity RtSpecies Glossary
Applications WB

Order Details

FAM108A1 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of rat FAM108A (NP_001006984 ). Peptide sequence GNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAA
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for FAM108A1 Antibody

  • abhydrolase domain-containing protein FAM108A1
  • C19orf27
  • chromosome 19 open reading frame 27
  • EC 3.-
  • family with sequence similarity 108, member A1
  • MGC5244


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, IHC-WhMt
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Pm, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB

Publications for FAM108A1 Antibody (NBP3-10857) (0)

There are no publications for FAM108A1 Antibody (NBP3-10857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM108A1 Antibody (NBP3-10857) (0)

There are no reviews for FAM108A1 Antibody (NBP3-10857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM108A1 Antibody (NBP3-10857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM108A1 Products

Bioinformatics Tool for FAM108A1 Antibody (NBP3-10857)

Discover related pathways, diseases and genes to FAM108A1 Antibody (NBP3-10857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM108A1 Antibody (NBP3-10857)

Discover more about diseases related to FAM108A1 Antibody (NBP3-10857).

Pathways for FAM108A1 Antibody (NBP3-10857)

View related products by pathway.

Blogs on FAM108A1

There are no specific blogs for FAM108A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM108A1 Antibody and receive a gift card or discount.


Gene Symbol ABHD17A