FAK Antibody (1D7)

Images

 
Western Blot: FAK Antibody (1D7) [H00005747-M03] - Analysis of PTK2 expression in Hela S3 NE (Cat # L013V3).
Western Blot: FAK Antibody (1D7) [H00005747-M03] - Analysis of PTK2 expression in Jurkat (Cat # L017V1).
Sandwich ELISA: FAK Antibody (1D7) [H00005747-M03] - Detection limit for recombinant GST tagged PTK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FAK Antibody (1D7) Summary

Immunogen
PTK2 (AAH28733 355 a.a. - 490 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Marker
Focal Adhesion Marker
Specificity
PTK2 - PTK2 protein tyrosine kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAK Antibody (1D7)

  • EC 2.7.10
  • FADK 1
  • FADK1
  • FADKFAK-related non-kinase polypeptide
  • FAK
  • FAK1FRNK
  • FAKEC 2.7.10.2
  • focal adhesion kinase 1
  • pp125FAK
  • Protein-tyrosine kinase 2
  • PTK2 protein tyrosine kinase 2
  • PTK2

Background

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. At least four transcript variants encoding four different isoforms have been found for this gene, but the full-length natures of only two of them have been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-07463
Species: Hu
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005747-M03
Species: Hu
Applications: WB, ELISA

Publications for FAK Antibody (H00005747-M03) (0)

There are no publications for FAK Antibody (H00005747-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAK Antibody (H00005747-M03) (0)

There are no reviews for FAK Antibody (H00005747-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAK Antibody (H00005747-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAK Products

Bioinformatics Tool for FAK Antibody (H00005747-M03)

Discover related pathways, diseases and genes to FAK Antibody (H00005747-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAK Antibody (H00005747-M03)

Discover more about diseases related to FAK Antibody (H00005747-M03).
 

Pathways for FAK Antibody (H00005747-M03)

View related products by pathway.

PTMs for FAK Antibody (H00005747-M03)

Learn more about PTMs related to FAK Antibody (H00005747-M03).
 

Research Areas for FAK Antibody (H00005747-M03)

Find related products by research area.

Blogs on FAK

There are no specific blogs for FAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAK Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTK2
Entrez
OMIM
Uniprot