Factor XIIIb Antibody

Images

 
Western Blot: Factor XIIIb Antibody [NBP1-89811] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human duodenum shows positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Factor XIIIb Antibody [NBP1-89811] - Staining of human placenta shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Factor XIIIb Antibody Summary

Immunogen
This antibody was developed against Recombinant Factor XIIIb Protein corresponding to amino acids: FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV
Specificity
Specificity of human Factor XIIIb antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F13B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Factor XIII Protein (NBP1-89811PEP)
Publications
Read Publications using NBP1-89811.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Factor XIIIb Antibody

  • coagulation factor XIII B chain
  • coagulation factor XIII, B polypeptide
  • F13B
  • fibrin-stabilizing factor B subunit
  • FXIIIB
  • protein-glutamine gamma-glutamyltransferase B chain
  • TGase
  • transglutaminase B chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-70696
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP2-32887
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6460
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP2-34062
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89811
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Factor XIIIb Antibody (NBP1-89811)(2)

Reviews for Factor XIIIb Antibody (NBP1-89811) (0)

There are no reviews for Factor XIIIb Antibody (NBP1-89811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor XIIIb Antibody (NBP1-89811). (Showing 1 - 1 of 1 FAQs).

  1. Regarding NBP1-89811 FXIII ab. Could you please tell me if this antibody recognizes the FXIII a subunits? Or both A and B? It cannot be seen from the datasheet, and I do not know the A subunit's sequence. Could you recommend an antibody directed to FXIII A?
    • This antibody detects FXIII B subunit. We do have several antibodies that detect the A subunit. As I do not know your planned application, I can not recommend one specifically, but you should be able to find one that suits your need.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Factor XIIIb Products

Bioinformatics Tool for Factor XIIIb Antibody (NBP1-89811)

Discover related pathways, diseases and genes to Factor XIIIb Antibody (NBP1-89811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor XIIIb Antibody (NBP1-89811)

Discover more about diseases related to Factor XIIIb Antibody (NBP1-89811).
 

Pathways for Factor XIIIb Antibody (NBP1-89811)

View related products by pathway.

Blogs on Factor XIIIb

There are no specific blogs for Factor XIIIb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor XIIIb Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F13B