Recombinant Human Factor XII heavy chain Protein

Images

 
SDS-Page: Recombinant Human Factor XII heavy chain Protein [H00002161-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Factor XII heavy chain Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 191-300 of Human Factor XII heavy chain

Source: Wheat Germ

Amino Acid Sequence: GHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
F12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Factor XII heavy chain Protein

  • beta-factor XIIa part 1
  • coagulation factor XII (Hageman factor)
  • coagulation factor XII
  • coagulation factor XIIa heavy chain
  • coagulation factor XIIa light chain
  • EC 3.4.21
  • EC 3.4.21.38
  • HAE3
  • HAEX
  • HAFbeta-factor XIIa part 2
  • Hageman factor

Background

F12 - coagulation factor XII (Hageman factor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
MAB1569
Species: Hu
Applications: WB, IHC, IP
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01) (0)

There are no publications for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01) (0)

There are no reviews for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01)

Discover related pathways, diseases and genes to Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01)

Discover more about diseases related to Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01).
 

Pathways for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01)

View related products by pathway.

PTMs for Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01)

Learn more about PTMs related to Factor XII heavy chain Partial Recombinant Protein (H00002161-Q01).

Blogs on Factor XII heavy chain

There are no specific blogs for Factor XII heavy chain, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Factor XII heavy chain Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F12