Recombinant Human Factor V GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Factor V Protein [H00002153-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Factor V GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-128 of Human Factor V

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AQLRQFYVAAQGISWSYRPEPTNSSLNLSVTSFKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYSKLSEGASY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
F5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Factor V GST (N-Term) Protein

  • Activated protein C cofactor
  • Cf5
  • Cf-5
  • Coagulation Factor 5
  • coagulation factor V (proaccelerin, labile factor)
  • coagulation factor V jinjiang A2 domain
  • Coagulation Factor V
  • F5
  • factor V Leiden
  • Factor V
  • FVL
  • PCCF
  • Proaccelerin, Labile Factor
  • RPRGL1
  • THPH2

Background

F5 - coagulation factor V (proaccelerin, labile factor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76966
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
DSE100
Species: Hu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF2338
Species: Hu
Applications: ICC, IP, WB
H00002153-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Factor V Partial Recombinant Protein (H00002153-Q01) (0)

There are no publications for Factor V Partial Recombinant Protein (H00002153-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor V Partial Recombinant Protein (H00002153-Q01) (0)

There are no reviews for Factor V Partial Recombinant Protein (H00002153-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor V Partial Recombinant Protein (H00002153-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor V Products

Bioinformatics Tool for Factor V Partial Recombinant Protein (H00002153-Q01)

Discover related pathways, diseases and genes to Factor V Partial Recombinant Protein (H00002153-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor V Partial Recombinant Protein (H00002153-Q01)

Discover more about diseases related to Factor V Partial Recombinant Protein (H00002153-Q01).
 

Pathways for Factor V Partial Recombinant Protein (H00002153-Q01)

View related products by pathway.

PTMs for Factor V Partial Recombinant Protein (H00002153-Q01)

Learn more about PTMs related to Factor V Partial Recombinant Protein (H00002153-Q01).

Blogs on Factor V.

Factor VIII - a key factor in the clotting process
Hemostasis, or blood clotting, follows tissue injury and involves the deployment of essential plasma procoagulants (such as prothrombin, and Factors X, IX, V, and VIII) that trigger the blood coagulation cascade. This cascade leads to the formation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Factor V GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F5