Recombinant Human FABP5/E-FABP Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FABP5/E-FABP Peptides and Proteins

Order Details


    • Catalog Number
      H00002171-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FABP5/E-FABP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-135 of Human FABP5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FABP5

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FABP5/E-FABP Protein

  • EFABP
  • E-FABP
  • E-FABPPAFABP
  • FABP5
  • fatty acid binding protein 5 (psoriasis-associated)
  • Fatty acid-binding protein 5
  • PA-FABPepidermal
  • Psoriasis-associated fatty acid-binding protein homolog

Background

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. FABP5( AAH19385, 1 a.a. - 136 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5866
Species: Hu
Applications: WB, IHC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for FABP5/E-FABP Recombinant Protein (H00002171-P01) (0)

There are no publications for FABP5/E-FABP Recombinant Protein (H00002171-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP5/E-FABP Recombinant Protein (H00002171-P01) (0)

There are no reviews for FABP5/E-FABP Recombinant Protein (H00002171-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP5/E-FABP Recombinant Protein (H00002171-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FABP5/E-FABP Products

Bioinformatics Tool for FABP5/E-FABP Recombinant Protein (H00002171-P01)

Discover related pathways, diseases and genes to FABP5/E-FABP Recombinant Protein (H00002171-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP5/E-FABP Recombinant Protein (H00002171-P01)

Discover more about diseases related to FABP5/E-FABP Recombinant Protein (H00002171-P01).
 

Pathways for FABP5/E-FABP Recombinant Protein (H00002171-P01)

View related products by pathway.

PTMs for FABP5/E-FABP Recombinant Protein (H00002171-P01)

Learn more about PTMs related to FABP5/E-FABP Recombinant Protein (H00002171-P01).
 

Research Areas for FABP5/E-FABP Recombinant Protein (H00002171-P01)

Find related products by research area.

Blogs on FABP5/E-FABP

There are no specific blogs for FABP5/E-FABP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FABP5/E-FABP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP5
Entrez