FABP3/H-FABP Antibody

Images

 
Western Blot: FABP3/H-FABP Antibody [H00002170-B01P] - Analysis of FABP3 expression in transfected 293T cell line by FABP3 polyclonal antibody. Lane 1: FABP3 transfected lysate(14.63 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FABP3/H-FABP Antibody Summary

Immunogen
FABP3 (NP_004093.1, 1 a.a. - 133 a.a.) full-length human protein. MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Specificity
FABP3 - fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FABP3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP3/H-FABP Antibody

  • FABP11
  • FABP3
  • fatty acid binding protein 11
  • fatty acid binding protein 3, muscle and heart (mammary-derived growthinhibitor)
  • Fatty acid-binding protein 3
  • Fatty acid-binding protein 3, muscle
  • fatty acid-binding protein, heart
  • Heart-type fatty acid-binding protein
  • HFABP
  • H-FABP
  • H-FABPM-FABP
  • Mammary-derived growth inhibitor
  • MDGI
  • Muscle fatty acid-binding protein
  • O-FABP

Background

The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NB100-2564
Species: Hu
Applications: WB

Publications for FABP3/H-FABP Antibody (H00002170-B01P) (0)

There are no publications for FABP3/H-FABP Antibody (H00002170-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP3/H-FABP Antibody (H00002170-B01P) (0)

There are no reviews for FABP3/H-FABP Antibody (H00002170-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP3/H-FABP Antibody (H00002170-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP3/H-FABP Products

Bioinformatics Tool for FABP3/H-FABP Antibody (H00002170-B01P)

Discover related pathways, diseases and genes to FABP3/H-FABP Antibody (H00002170-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP3/H-FABP Antibody (H00002170-B01P)

Discover more about diseases related to FABP3/H-FABP Antibody (H00002170-B01P).
 

Pathways for FABP3/H-FABP Antibody (H00002170-B01P)

View related products by pathway.

PTMs for FABP3/H-FABP Antibody (H00002170-B01P)

Learn more about PTMs related to FABP3/H-FABP Antibody (H00002170-B01P).

Blogs on FABP3/H-FABP

There are no specific blogs for FABP3/H-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP3/H-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP3
Entrez
Uniprot