FABP1/L-FABP Antibody

Images

 
Western Blot: FABP1/L-FABP Antibody [H00002168-D03P] - Analysis of FABP1 expression in mouse liver.
Western Blot: FABP1/L-FABP Antibody [H00002168-D03P] - Analysis of FABP1 expression in human liver.
Western Blot: FABP1/L-FABP Antibody [H00002168-D03P] - Analysis of FABP1 expression in transfected 293T cell line by FABP1 polyclonal antibody.Lane 1: FABP1 transfected lysate(14.08 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FABP1/L-FABP Antibody Summary

Immunogen
FABP1 (AAH32801, 1 a.a. - 127 a.a.) full-length human protein. MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Specificity
FABP1 - fatty acid binding protein 1, liver,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FABP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP1/L-FABP Antibody

  • FABP1
  • FABPL
  • fatty acid binding protein 1, liver
  • fatty acid-binding protein, liver
  • LFABP
  • L-FABP
  • L-FABPFatty acid-binding protein 1
  • Liver-type fatty acid-binding protein

Background

FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF1857
Species: Mu
Applications: WB, Simple Western, IP
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF2009
Species: Hu
Applications: WB, IHC
H00002168-D03P
Species: Hu, Mu
Applications: WB

Publications for FABP1/L-FABP Antibody (H00002168-D03P) (0)

There are no publications for FABP1/L-FABP Antibody (H00002168-D03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP1/L-FABP Antibody (H00002168-D03P) (0)

There are no reviews for FABP1/L-FABP Antibody (H00002168-D03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP1/L-FABP Antibody (H00002168-D03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP1/L-FABP Products

Bioinformatics Tool for FABP1/L-FABP Antibody (H00002168-D03P)

Discover related pathways, diseases and genes to FABP1/L-FABP Antibody (H00002168-D03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP1/L-FABP Antibody (H00002168-D03P)

Discover more about diseases related to FABP1/L-FABP Antibody (H00002168-D03P).
 

Pathways for FABP1/L-FABP Antibody (H00002168-D03P)

View related products by pathway.

PTMs for FABP1/L-FABP Antibody (H00002168-D03P)

Learn more about PTMs related to FABP1/L-FABP Antibody (H00002168-D03P).
 

Research Areas for FABP1/L-FABP Antibody (H00002168-D03P)

Find related products by research area.

Blogs on FABP1/L-FABP

There are no specific blogs for FABP1/L-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP1/L-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP1
Entrez
Uniprot