FABP1/L-FABP Antibody (5E7.)

Images

 
Sandwich ELISA: FABP1/L-FABP Antibody (5E7) [H00002168-M04] - Detection limit for recombinant GST tagged FABP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related FABP1/L-FABP Primary Antibodies

Order Details


    • Catalog Number
      H00002168-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FABP1/L-FABP Antibody (5E7.) Summary

Immunogen
FABP1 (AAH32801, 1 a.a. - 127 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Specificity
FABP1 - fatty acid binding protein 1, liver (5E7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FABP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP1/L-FABP Antibody (5E7.)

  • FABP1
  • FABPL
  • fatty acid binding protein 1, liver
  • fatty acid-binding protein, liver
  • LFABP
  • L-FABP
  • L-FABPFatty acid-binding protein 1
  • Liver-type fatty acid-binding protein

Background

FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF1857
Species: Mu
Applications: WB, Simple Western, IP
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF2009
Species: Hu
Applications: WB, IHC
H00002168-M04
Species: Hu
Applications: WB, ELISA

Publications for FABP1/L-FABP Antibody (H00002168-M04) (0)

There are no publications for FABP1/L-FABP Antibody (H00002168-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP1/L-FABP Antibody (H00002168-M04) (0)

There are no reviews for FABP1/L-FABP Antibody (H00002168-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP1/L-FABP Antibody (H00002168-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP1/L-FABP Products

Bioinformatics Tool for FABP1/L-FABP Antibody (H00002168-M04)

Discover related pathways, diseases and genes to FABP1/L-FABP Antibody (H00002168-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP1/L-FABP Antibody (H00002168-M04)

Discover more about diseases related to FABP1/L-FABP Antibody (H00002168-M04).
 

Pathways for FABP1/L-FABP Antibody (H00002168-M04)

View related products by pathway.

PTMs for FABP1/L-FABP Antibody (H00002168-M04)

Learn more about PTMs related to FABP1/L-FABP Antibody (H00002168-M04).
 

Research Areas for FABP1/L-FABP Antibody (H00002168-M04)

Find related products by research area.

Blogs on FABP1/L-FABP

There are no specific blogs for FABP1/L-FABP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP1/L-FABP Antibody (5E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP1
Entrez
Uniprot