Recombinant Human EYA3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EYA3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-103 of Human EYA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASD

Protein/Peptide Type
Partial Recombinant Protein
Gene
EYA3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EYA3 Protein

  • DKFZp686C132
  • EC 3.1.3.48
  • eyes absent (Drosophila) homolog 3
  • eyes absent 3
  • eyes absent homolog 3 (Drosophila)
  • eyes absent homolog 3

Background

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-84026
Species: Hu
Applications: WB, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007008-T01
Species: Hu
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00010736-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, RNAi SP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00051804-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002140-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EYA3 Partial Recombinant Protein (H00002140-Q01) (0)

There are no publications for EYA3 Partial Recombinant Protein (H00002140-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA3 Partial Recombinant Protein (H00002140-Q01) (0)

There are no reviews for EYA3 Partial Recombinant Protein (H00002140-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYA3 Partial Recombinant Protein (H00002140-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EYA3 Products

Bioinformatics Tool for EYA3 Partial Recombinant Protein (H00002140-Q01)

Discover related pathways, diseases and genes to EYA3 Partial Recombinant Protein (H00002140-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA3 Partial Recombinant Protein (H00002140-Q01)

Discover more about diseases related to EYA3 Partial Recombinant Protein (H00002140-Q01).
 

Pathways for EYA3 Partial Recombinant Protein (H00002140-Q01)

View related products by pathway.

PTMs for EYA3 Partial Recombinant Protein (H00002140-Q01)

Learn more about PTMs related to EYA3 Partial Recombinant Protein (H00002140-Q01).
 

Research Areas for EYA3 Partial Recombinant Protein (H00002140-Q01)

Find related products by research area.

Blogs on EYA3

There are no specific blogs for EYA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EYA3 Antibody
NBP1-46818

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EYA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA3