EYA2 Antibody

Images

 
Western Blot: EYA2 Antibody [NBP1-82375] - Rat Muscle Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Product Discontinued
View other related EYA2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-82375
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EYA2 Antibody Summary

Immunogen
Synthetic peptide towards Eya2. Peptide sequence EAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRS.
Clonality
Polyclonal
Host
Rabbit
Gene
EYA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Eya2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EYA2 Antibody

  • EAB1EC 3.1.3.48
  • eyes absent (Drosophila) homolog 2
  • eyes absent homolog 2 (Drosophila)
  • eyes absent homolog 2
  • MGC10614

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
NBP1-46818
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
113-BP/CF
Species: Hu
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85547
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85009
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-82375
Species: Rt
Applications: WB

Publications for EYA2 Antibody (NBP1-82375) (0)

There are no publications for EYA2 Antibody (NBP1-82375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA2 Antibody (NBP1-82375) (0)

There are no reviews for EYA2 Antibody (NBP1-82375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYA2 Antibody (NBP1-82375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EYA2 Antibody (NBP1-82375)

Discover related pathways, diseases and genes to EYA2 Antibody (NBP1-82375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA2 Antibody (NBP1-82375)

Discover more about diseases related to EYA2 Antibody (NBP1-82375).
 

Pathways for EYA2 Antibody (NBP1-82375)

View related products by pathway.

PTMs for EYA2 Antibody (NBP1-82375)

Learn more about PTMs related to EYA2 Antibody (NBP1-82375).

Blogs on EYA2

There are no specific blogs for EYA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA2
Uniprot