Recombinant Human Exportin-T Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Exportin-T Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human Exportin-T

Source: Wheat Germ

Amino Acid Sequence: MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
XPOT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Exportin-T Protein

  • exportin(tRNA)
  • exportin, tRNA (nuclear export receptor for tRNAs)
  • exportin-T
  • tRNA exportin
  • XPO3

Background

This gene encodes a protein belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19562
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-591
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00011260-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Exportin-T Partial Recombinant Protein (H00011260-Q01) (0)

There are no publications for Exportin-T Partial Recombinant Protein (H00011260-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exportin-T Partial Recombinant Protein (H00011260-Q01) (0)

There are no reviews for Exportin-T Partial Recombinant Protein (H00011260-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exportin-T Partial Recombinant Protein (H00011260-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Exportin-T Products

Bioinformatics Tool for Exportin-T Partial Recombinant Protein (H00011260-Q01)

Discover related pathways, diseases and genes to Exportin-T Partial Recombinant Protein (H00011260-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exportin-T Partial Recombinant Protein (H00011260-Q01)

Discover more about diseases related to Exportin-T Partial Recombinant Protein (H00011260-Q01).
 

Pathways for Exportin-T Partial Recombinant Protein (H00011260-Q01)

View related products by pathway.

Blogs on Exportin-T

There are no specific blogs for Exportin-T, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Exportin-T Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol XPOT