Recombinant Human Exostosin 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Exostosin 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00002134-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Exostosin 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human EXTL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EXT1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Exostosin 1 Protein

  • EC 2.4.1.224
  • EC 2.4.1.225
  • exostoses (multiple) 1
  • Exostosin 1
  • exostosin-1
  • EXT
  • EXT1
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
  • Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase
  • Langer-Giedion syndrome chromosome region
  • LGCR
  • LGS
  • Multiple exostoses protein 1
  • N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
  • Putative tumor suppressor protein EXT1
  • TRPS2
  • TTV

Background

EXTL1 - exostoses (multiple)-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
1705-HH/CF
Species: Hu, Mu
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF2536
Species: Mu
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
AF4838
Species: Hu
Applications: WB, Simple Western
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-57016
Species: Hu
Applications: WB
MAB4214
Species: Mu
Applications: WB, IP
H00002134-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Exostosin 1 Partial Recombinant Protein (H00002134-Q01) (0)

There are no publications for Exostosin 1 Partial Recombinant Protein (H00002134-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exostosin 1 Partial Recombinant Protein (H00002134-Q01) (0)

There are no reviews for Exostosin 1 Partial Recombinant Protein (H00002134-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exostosin 1 Partial Recombinant Protein (H00002134-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Exostosin 1 Products

Bioinformatics Tool for Exostosin 1 Partial Recombinant Protein (H00002134-Q01)

Discover related pathways, diseases and genes to Exostosin 1 Partial Recombinant Protein (H00002134-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exostosin 1 Partial Recombinant Protein (H00002134-Q01)

Discover more about diseases related to Exostosin 1 Partial Recombinant Protein (H00002134-Q01).
 

Pathways for Exostosin 1 Partial Recombinant Protein (H00002134-Q01)

View related products by pathway.

PTMs for Exostosin 1 Partial Recombinant Protein (H00002134-Q01)

Learn more about PTMs related to Exostosin 1 Partial Recombinant Protein (H00002134-Q01).
 

Research Areas for Exostosin 1 Partial Recombinant Protein (H00002134-Q01)

Find related products by research area.

Blogs on Exostosin 1

There are no specific blogs for Exostosin 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Exostosin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EXT1
Entrez