Exosome component 10 Antibody

Images

 
Western Blot: Exosome component 10 Antibody [NBP1-57183] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-57183] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with ...read more

Product Details

Summary
Product Discontinued
View other related Exosome component 10 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57183
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Exosome component 10 Antibody Summary

Immunogen
Synthetic peptides corresponding to Exosome component 10 The peptide sequence was selected from the C terminal of Exosome component 10. Peptide sequence FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG.
Clonality
Polyclonal
Host
Rabbit
Gene
EXOSC10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Exosome component 10 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Exosome component 10 Antibody

  • autoantigen PM-SCL
  • EC 3.1.13.-
  • exosome component 10
  • P100 polymyositis-scleroderma overlap syndrome-associated autoantigen
  • p2
  • p3
  • p4
  • PM/Scl-100Autoantigen PM/Scl 2
  • PM-Scl
  • PMSCL2PMSCL
  • polymyositis/scleroderma autoantigen 2 (100kD)
  • Polymyositis/scleroderma autoantigen 2
  • polymyositis/scleroderma autoantigen 2, 100kDa
  • RRP6
  • Rrp6p
  • RRP6Polymyositis/scleroderma autoantigen 100 kDa

Background

EXOSC10(Exosome component 10) contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Exosome component 10 Antibody (NBP1-57183) (0)

There are no publications for Exosome component 10 Antibody (NBP1-57183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 10 Antibody (NBP1-57183) (0)

There are no reviews for Exosome component 10 Antibody (NBP1-57183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 10 Antibody (NBP1-57183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Exosome component 10 Products

Bioinformatics Tool for Exosome component 10 Antibody (NBP1-57183)

Discover related pathways, diseases and genes to Exosome component 10 Antibody (NBP1-57183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 10 Antibody (NBP1-57183)

Discover more about diseases related to Exosome component 10 Antibody (NBP1-57183).
 

Pathways for Exosome component 10 Antibody (NBP1-57183)

View related products by pathway.

PTMs for Exosome component 10 Antibody (NBP1-57183)

Learn more about PTMs related to Exosome component 10 Antibody (NBP1-57183).

Blogs on Exosome component 10

There are no specific blogs for Exosome component 10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Exosome component 10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC10
Uniprot