EXOC2 Antibody

Images

 
Western Blot: EXOC2 Antibody [NBP1-83785] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: EXOC2 Antibody [NBP1-83785] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: EXOC2 Antibody [NBP1-83785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Product Discontinued
View other related EXOC2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83785
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EXOC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AWYLIENHSNTSFEQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQKLENVLNRASNTADTLFQEVLGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EXOC2 Antibody

  • exocyst complex component 2
  • Exocyst complex component Sec5
  • FLJ11026
  • SEC5
  • SEC5L1
  • SEC5-like 1 (S. cerevisiae)
  • SEC5-like 1
  • Sec5p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85031
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3920
Species: Hu
Applications: WB
NBP2-31841
Species: Hu
Applications: IHC, IHC-P
NBP1-86344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91444
Species: Hu
Applications: WB
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-34078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-83785
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for EXOC2 Antibody (NBP1-83785) (0)

There are no publications for EXOC2 Antibody (NBP1-83785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXOC2 Antibody (NBP1-83785) (0)

There are no reviews for EXOC2 Antibody (NBP1-83785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EXOC2 Antibody (NBP1-83785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EXOC2 Products

Bioinformatics Tool for EXOC2 Antibody (NBP1-83785)

Discover related pathways, diseases and genes to EXOC2 Antibody (NBP1-83785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXOC2 Antibody (NBP1-83785)

Discover more about diseases related to EXOC2 Antibody (NBP1-83785).
 

Pathways for EXOC2 Antibody (NBP1-83785)

View related products by pathway.

PTMs for EXOC2 Antibody (NBP1-83785)

Learn more about PTMs related to EXOC2 Antibody (NBP1-83785).

Blogs on EXOC2

There are no specific blogs for EXOC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXOC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC2