Ets-1 Antibody

Images

 
Western Blot: Ets-1 Antibody [H00002113-D01P] - Analysis of ETS1 expression in mouse intestine.
Western Blot: Ets-1 Antibody [H00002113-D01P] - Analysis of ETS1 expression in human spleen.
Western Blot: Ets-1 Antibody [H00002113-D01P] - Analysis of ETS1 expression in transfected 293T cell line by ETS1 polyclonal antibody.Lane 1: ETS1 transfected lysate(50.40 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Ets-1 Antibody [H00002113-D01P] - Analysis of protein-protein interactions between ETS1 and MAPK1. HeLa cells were stained with anti-ETS1 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ets-1 Antibody Summary

Immunogen
ETS1 (NP_005229.1, 1 a.a. - 441 a.a.) full-length human protein. MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
Specificity
ETS1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
It has been used for ELISA and WB.
Publications
Read Publication using H00002113-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ets-1 Antibody

  • Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1
  • ets protein
  • Ets1
  • Ets-1
  • EWSR2
  • FLJ10768
  • p54
  • Protein C-Ets-1
  • v-ets avian erythroblastosis virus E2 oncogene homolog 1
  • v-ets avian erythroblastosis virus E26 oncogene homolog 1
  • v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
  • v-ets

Background

ETS transcriptions factors, such as ETS1, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-14951
Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ets-1 Antibody (H00002113-D01P)(1)

Reviews for Ets-1 Antibody (H00002113-D01P) (0)

There are no reviews for Ets-1 Antibody (H00002113-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ets-1 Antibody (H00002113-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ets-1 Products

Bioinformatics Tool for Ets-1 Antibody (H00002113-D01P)

Discover related pathways, diseases and genes to Ets-1 Antibody (H00002113-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ets-1 Antibody (H00002113-D01P)

Discover more about diseases related to Ets-1 Antibody (H00002113-D01P).
 

Pathways for Ets-1 Antibody (H00002113-D01P)

View related products by pathway.

PTMs for Ets-1 Antibody (H00002113-D01P)

Learn more about PTMs related to Ets-1 Antibody (H00002113-D01P).
 

Research Areas for Ets-1 Antibody (H00002113-D01P)

Find related products by research area.

Blogs on Ets-1.

HIF-3 alpha: a versatile target with hypoxia dependent and independent functions
By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ets-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETS1
Entrez
Uniprot