ETFB Antibody

Images

 
Western Blot: ETFB Antibody [NBP1-54705] - Human Heart lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: ETFB Antibody [NBP1-54705] - Human MCF7, Antibody Dilution: 1.0 ug/ml ETFB is supported by BioGPS gene expression data to be expressed in MCF7.

Product Details

Summary
Product Discontinued
View other related ETFB Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54705
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ETFB Antibody Summary

Immunogen
Synthetic peptides corresponding to ETFB(electron-transfer-flavoprotein, beta polypeptide) The peptide sequence was selected from the C terminal of ETFB. Peptide sequence TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP.
Specificity
This product is specific to Subunit or Isofrom: beta.
Clonality
Polyclonal
Host
Rabbit
Gene
ETFB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ETFB and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ETFB Antibody

  • beta-ETF
  • electron transfer flavoprotein beta subunit
  • electron transfer flavoprotein beta-subunit
  • electron transfer flavoprotein subunit beta
  • electron transfer flavoprotein, beta polypeptide
  • electron-transfer-flavoprotein, beta polypeptide
  • electron-transferring-flavoprotein, beta polypeptide
  • MADD

Background

ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. This gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-33787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94053
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54705
Species: Hu
Applications: WB, IHC

Publications for ETFB Antibody (NBP1-54705) (0)

There are no publications for ETFB Antibody (NBP1-54705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETFB Antibody (NBP1-54705) (0)

There are no reviews for ETFB Antibody (NBP1-54705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ETFB Antibody (NBP1-54705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ETFB Products

Bioinformatics Tool for ETFB Antibody (NBP1-54705)

Discover related pathways, diseases and genes to ETFB Antibody (NBP1-54705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETFB Antibody (NBP1-54705)

Discover more about diseases related to ETFB Antibody (NBP1-54705).
 

Pathways for ETFB Antibody (NBP1-54705)

View related products by pathway.

PTMs for ETFB Antibody (NBP1-54705)

Learn more about PTMs related to ETFB Antibody (NBP1-54705).
 

Research Areas for ETFB Antibody (NBP1-54705)

Find related products by research area.

Blogs on ETFB

There are no specific blogs for ETFB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETFB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETFB
Uniprot