ESRP2 Antibody


Western Blot: ESRP2 Antibody [NBP1-74188] - Mouse Liver Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related ESRP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ESRP2 Antibody Summary

Synthetic peptides corresponding to thelial splicing regulatory protein 2 Antibody against the C terminal of Esrp2. Immunizing peptide sequence LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Esrp2 and was validated on Western blot.
Positive Control
ESRP2 Lysate (NBP2-65038)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ESRP2 Antibody

  • epithelial splicing regulatory protein 2
  • FLJ21918
  • FLJ22248
  • RBM35BRNA-binding protein 35B
  • RNA binding motif protein 35A
  • RNA binding motif protein 35B
  • RNA-binding motif protein 35B


Esrp2 is an mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. It specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. It also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). It acts by directly binding specific sequences in mRNAs and binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ESRP2 Antibody (NBP1-74188) (0)

There are no publications for ESRP2 Antibody (NBP1-74188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESRP2 Antibody (NBP1-74188) (0)

There are no reviews for ESRP2 Antibody (NBP1-74188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ESRP2 Antibody (NBP1-74188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ESRP2 Products

Bioinformatics Tool for ESRP2 Antibody (NBP1-74188)

Discover related pathways, diseases and genes to ESRP2 Antibody (NBP1-74188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESRP2 Antibody (NBP1-74188)

Discover more about diseases related to ESRP2 Antibody (NBP1-74188).

Pathways for ESRP2 Antibody (NBP1-74188)

View related products by pathway.

Blogs on ESRP2

There are no specific blogs for ESRP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ESRP2 Antibody and receive a gift card or discount.


Gene Symbol ESRP2