Recombinant Human ESAM Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ESAM Peptides and Proteins

Order Details


    • Catalog Number
      H00090952-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ESAM Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 390 of Human ESAM full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
ESAM

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ESAM Protein

  • 2310008D05Rik
  • endothelial cell adhesion molecule
  • endothelial cell-selective adhesion molecule
  • ESAM
  • HUEL (C4orf1)-interacting protein
  • LP4791 protein
  • W117m

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
796-IC
Species: Mu
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-89671
Species: Hu
Applications: WB, IHC, IHC-P
H00090952-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ESAM Recombinant Protein (H00090952-P01) (0)

There are no publications for ESAM Recombinant Protein (H00090952-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESAM Recombinant Protein (H00090952-P01) (0)

There are no reviews for ESAM Recombinant Protein (H00090952-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ESAM Recombinant Protein (H00090952-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ESAM Products

Bioinformatics Tool for ESAM Recombinant Protein (H00090952-P01)

Discover related pathways, diseases and genes to ESAM Recombinant Protein (H00090952-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESAM Recombinant Protein (H00090952-P01)

Discover more about diseases related to ESAM Recombinant Protein (H00090952-P01).
 

Pathways for ESAM Recombinant Protein (H00090952-P01)

View related products by pathway.

PTMs for ESAM Recombinant Protein (H00090952-P01)

Learn more about PTMs related to ESAM Recombinant Protein (H00090952-P01).

Blogs on ESAM

There are no specific blogs for ESAM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ESAM Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ESAM
Entrez