Erythropoietin R Antibody


Western Blot: EPO Receptor Antibody [NBP1-80532] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Liver.

Product Details

Product Discontinued
View other related Erythropoietin R Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Erythropoietin R Antibody Summary

Synthetic peptide directed towards the N terminal of human Epor. Peptide sequence SVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Epor and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Erythropoietin R Antibody

  • EpoR
  • EPO-R
  • Erythropoietin R
  • erythropoietin receptor
  • MGC138358


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Neut
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Species: Hu, Mu
Applications: WB, Simple Western, IP

Publications for Erythropoietin R Antibody (NBP1-80532) (0)

There are no publications for Erythropoietin R Antibody (NBP1-80532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Erythropoietin R Antibody (NBP1-80532) (0)

There are no reviews for Erythropoietin R Antibody (NBP1-80532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Erythropoietin R Antibody (NBP1-80532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Erythropoietin R Antibody (NBP1-80532)

Discover related pathways, diseases and genes to Erythropoietin R Antibody (NBP1-80532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Erythropoietin R Antibody (NBP1-80532)

Discover more about diseases related to Erythropoietin R Antibody (NBP1-80532).

Pathways for Erythropoietin R Antibody (NBP1-80532)

View related products by pathway.

PTMs for Erythropoietin R Antibody (NBP1-80532)

Learn more about PTMs related to Erythropoietin R Antibody (NBP1-80532).

Blogs on Erythropoietin R

There are no specific blogs for Erythropoietin R, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Erythropoietin R Antibody and receive a gift card or discount.


Gene Symbol EPOR