Erythropoietin Antibody

Images

 
Western Blot: Erythropoietin Antibody [H00002056-D01P] - Analysis of EPO expression in transfected 293T cell line by EPO polyclonal antibody.Lane 1: EPO transfected lysate(21.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Erythropoietin Antibody Summary

Immunogen
EPO (NP_000790.2, 1 a.a. - 193 a.a.) full-length human protein. MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Specificity
EPO - erythropoietin,
Clonality
Polyclonal
Host
Rabbit
Gene
EPO
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Erythropoietin Antibody

  • EP
  • EPO
  • epoetin
  • Erythropoietin
  • MGC138142
  • MVCD2

Background

This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB214R
Species: Hu
Applications: ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-22975
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB214R
Species: Hu
Applications: ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, TCS, LA
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB15841
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002056-D01P
Species: Hu
Applications: WB

Publications for Erythropoietin Antibody (H00002056-D01P) (0)

There are no publications for Erythropoietin Antibody (H00002056-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Erythropoietin Antibody (H00002056-D01P) (0)

There are no reviews for Erythropoietin Antibody (H00002056-D01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Erythropoietin Antibody (H00002056-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Erythropoietin Antibody Products

Related Products by Gene

Bioinformatics Tool for Erythropoietin Antibody (H00002056-D01P)

Discover related pathways, diseases and genes to Erythropoietin Antibody (H00002056-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Erythropoietin Antibody (H00002056-D01P)

Discover more about diseases related to Erythropoietin Antibody (H00002056-D01P).
 

Pathways for Erythropoietin Antibody (H00002056-D01P)

View related products by pathway.

PTMs for Erythropoietin Antibody (H00002056-D01P)

Learn more about PTMs related to Erythropoietin Antibody (H00002056-D01P).
 

Research Areas for Erythropoietin Antibody (H00002056-D01P)

Find related products by research area.

Blogs on Erythropoietin.

HIF-2 alpha Antibody Throws New Light on EPO Dilemma
The HIF family are heterodimeric, oxygen-sensitive transcription factors comprising an alpha and beta subunit which are normally dissociated in normoxic conditions. Our antibody catalog contains products targeting all the Hypoxia Inducible Factor isof...  Read full blog post.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

Hypoxia-Inducible Factors and Homeostasis
Hypoxia-Inducible Factor-1 (HIF-1) is a highly conserved heterodimeric transcription factor. Novus' antibody catalogue contains an extensive range of both HIF-1 alpha and HIF-1 beta, useful for hypoxia, angiogenesis, cancer and many other areas of res...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our Erythropoietin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPO
Entrez
Uniprot

Customers Who Bought This Also Bought