Recombinant Human ERRFI1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ERRFI1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 111-220 of Human MIG-6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ERRFI1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERRFI1 Protein

  • ERBB receptor feedback inhibitor 1
  • GENE-33
  • MIG6
  • MIG-6Mitogen-inducible gene 6 protein
  • RALTreceptor-associated late transducer

Background

ERRFI1 - mitogen-inducible gene 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-32311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB5628
Species: Hu, Mu
Applications: WB
AF3688
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB5808
Species: Hu
Applications: WB, ICC
NB100-56639
Species: Hu, Mu
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western

Publications for ERRFI1 Partial Recombinant Protein (H00054206-Q01) (0)

There are no publications for ERRFI1 Partial Recombinant Protein (H00054206-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERRFI1 Partial Recombinant Protein (H00054206-Q01) (0)

There are no reviews for ERRFI1 Partial Recombinant Protein (H00054206-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERRFI1 Partial Recombinant Protein (H00054206-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERRFI1 Products

Bioinformatics Tool for ERRFI1 Partial Recombinant Protein (H00054206-Q01)

Discover related pathways, diseases and genes to ERRFI1 Partial Recombinant Protein (H00054206-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERRFI1 Partial Recombinant Protein (H00054206-Q01)

Discover more about diseases related to ERRFI1 Partial Recombinant Protein (H00054206-Q01).
 

Pathways for ERRFI1 Partial Recombinant Protein (H00054206-Q01)

View related products by pathway.

PTMs for ERRFI1 Partial Recombinant Protein (H00054206-Q01)

Learn more about PTMs related to ERRFI1 Partial Recombinant Protein (H00054206-Q01).

Blogs on ERRFI1

There are no specific blogs for ERRFI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ERRFI1 Antibody
NBP2-16372

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERRFI1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERRFI1