ERp72 Antibody


Western Blot: ERp72 Antibody [NBP1-69560] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PDIA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: ERp72 Antibody [NBP1-69560] - This Anti-PDIA4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Western Blot: ERp72 Antibody [NBP1-69560] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml PDIA4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

Product Details

Product Discontinued
View other related ERp72 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERp72 Antibody Summary

Synthetic peptides corresponding to PDIA4(protein disulfide isomerase family A, member 4) The peptide sequence was selected from the middle region of PDIA4. Peptide sequence TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA.
Endoplasmic Reticulum Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDIA4 and was validated on Western blot.
Theoretical MW
73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ERp72 Antibody

  • Endoplasmic reticulum resident protein 70
  • Endoplasmic reticulum resident protein 72
  • ER protein 70
  • ERp70
  • ERP70ER protein 72
  • ERp72
  • ERp-72
  • ERP72EC
  • intestinal-related)
  • protein disulfide isomerase family A, member 4
  • protein disulfide isomerase related protein (calcium-binding protein
  • protein disulfide isomerase-associated 4
  • protein disulfide-isomerase A4


The specific function of PDIA4 is not yet known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ERp72 Antibody (NBP1-69560) (0)

There are no publications for ERp72 Antibody (NBP1-69560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERp72 Antibody (NBP1-69560) (0)

There are no reviews for ERp72 Antibody (NBP1-69560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERp72 Antibody (NBP1-69560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ERp72 Products

Bioinformatics Tool for ERp72 Antibody (NBP1-69560)

Discover related pathways, diseases and genes to ERp72 Antibody (NBP1-69560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp72 Antibody (NBP1-69560)

Discover more about diseases related to ERp72 Antibody (NBP1-69560).

Pathways for ERp72 Antibody (NBP1-69560)

View related products by pathway.

PTMs for ERp72 Antibody (NBP1-69560)

Learn more about PTMs related to ERp72 Antibody (NBP1-69560).

Research Areas for ERp72 Antibody (NBP1-69560)

Find related products by research area.

Blogs on ERp72

There are no specific blogs for ERp72, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ERp72 Antibody and receive a gift card or discount.


Gene Symbol PDIA4