Recombinant Human ERMAP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ERMAP Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 376 - 475 of Human ERMAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ERMAP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERMAP Protein

  • ERMAP
  • erythroblast membrane-associated protein (RD and SC blood groups)
  • erythroblast membrane-associated protein (Scianna blood group)
  • erythroblast membrane-associated protein
  • erythroid membrane-associated protein
  • hERMAP
  • MGC118810
  • MGC118811
  • PRO2801
  • Radin blood group (Rd)
  • Radin blood group antigen
  • Radin blood group
  • RD
  • RDMGC118812
  • SC
  • Scianna blood group (Sc)
  • Scianna blood group antigen
  • Scianna blood group
  • SCMGC118813

Background

ERMAP - erythroblast membrane-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00114625-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ERMAP Partial Recombinant Protein (H00114625-Q01) (0)

There are no publications for ERMAP Partial Recombinant Protein (H00114625-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERMAP Partial Recombinant Protein (H00114625-Q01) (0)

There are no reviews for ERMAP Partial Recombinant Protein (H00114625-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERMAP Partial Recombinant Protein (H00114625-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERMAP Products

Bioinformatics Tool for ERMAP Partial Recombinant Protein (H00114625-Q01)

Discover related pathways, diseases and genes to ERMAP Partial Recombinant Protein (H00114625-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERMAP Partial Recombinant Protein (H00114625-Q01)

Discover more about diseases related to ERMAP Partial Recombinant Protein (H00114625-Q01).
 

Pathways for ERMAP Partial Recombinant Protein (H00114625-Q01)

View related products by pathway.

PTMs for ERMAP Partial Recombinant Protein (H00114625-Q01)

Learn more about PTMs related to ERMAP Partial Recombinant Protein (H00114625-Q01).

Blogs on ERMAP

There are no specific blogs for ERMAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERMAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERMAP
Entrez