ERMAP Antibody


Western Blot: ERMAP Antibody [NBP1-69511] - This Anti-ERMAP antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related ERMAP Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERMAP Antibody Summary

Synthetic peptides corresponding to ERMAP(erythroblast membrane-associated protein (Scianna blood group)) The peptide sequence was selected from the middle region of ERMAP. Peptide sequence RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ERMAP and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ERMAP Antibody

  • erythroblast membrane-associated protein (RD and SC blood groups)
  • erythroblast membrane-associated protein (Scianna blood group)
  • erythroblast membrane-associated protein
  • erythroid membrane-associated protein
  • hERMAP
  • MGC118810
  • MGC118811
  • PRO2801
  • Radin blood group (Rd)
  • Radin blood group antigen
  • Radin blood group
  • RD
  • RDMGC118812
  • SC
  • Scianna blood group (Sc)
  • Scianna blood group antigen
  • Scianna blood group
  • SCMGC118813


ERMAP is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in the gene encoding ERMAP protein are responsible for the Scianna/Radin blood group system. The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for ERMAP Antibody (NBP1-69511) (0)

There are no publications for ERMAP Antibody (NBP1-69511).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERMAP Antibody (NBP1-69511) (0)

There are no reviews for ERMAP Antibody (NBP1-69511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERMAP Antibody (NBP1-69511) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ERMAP Products

Bioinformatics Tool for ERMAP Antibody (NBP1-69511)

Discover related pathways, diseases and genes to ERMAP Antibody (NBP1-69511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERMAP Antibody (NBP1-69511)

Discover more about diseases related to ERMAP Antibody (NBP1-69511).

Pathways for ERMAP Antibody (NBP1-69511)

View related products by pathway.

PTMs for ERMAP Antibody (NBP1-69511)

Learn more about PTMs related to ERMAP Antibody (NBP1-69511).

Blogs on ERMAP

There are no specific blogs for ERMAP, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ERMAP Antibody and receive a gift card or discount.


Gene Symbol ERMAP