ERLIN1 Antibody


Western Blot: ERLIN1 Antibody [NBP1-69567] - Human 721_B, Antibody Dilution: 1.0 ug/ml ERLIN1 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: ERLIN1 Antibody [NBP1-69567] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: HepG2 cell lysate ERLIN1 is strongly supported by BioGPS gene expression data to be expressed in more
Western Blot: ERLIN1 Antibody [NBP1-69567] - Human MCF7, Antibody Dilution: 1.0 ug/ml ERLIN1 is supported by BioGPS gene expression data to be expressed in MCF7.

Product Details

Product Discontinued
View other related ERLIN1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERLIN1 Antibody Summary

Synthetic peptides corresponding to ERLIN1(ER lipid raft associated 1) The peptide sequence was selected from the N terminal of ERLIN1. Peptide sequence KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ERLIN1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ERLIN1 Antibody

  • Band_7 23-211 Keo4 (Interim) similar to C.elegans protein C42C1.9
  • C10orf69
  • chromosome 10 open reading frame 69
  • Endoplasmic reticulum lipid raft-associated protein 1
  • ER lipid raft associated 1
  • Erlin-1
  • KE04SPFH domain-containing protein 1
  • KEO4
  • Protein KE04
  • SPFH domain family, member 1
  • SPFH1
  • Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1


Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for ERLIN1 Antibody (NBP1-69567) (0)

There are no publications for ERLIN1 Antibody (NBP1-69567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERLIN1 Antibody (NBP1-69567) (0)

There are no reviews for ERLIN1 Antibody (NBP1-69567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERLIN1 Antibody (NBP1-69567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ERLIN1 Products

Bioinformatics Tool for ERLIN1 Antibody (NBP1-69567)

Discover related pathways, diseases and genes to ERLIN1 Antibody (NBP1-69567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERLIN1 Antibody (NBP1-69567)

Discover more about diseases related to ERLIN1 Antibody (NBP1-69567).

Pathways for ERLIN1 Antibody (NBP1-69567)

View related products by pathway.

PTMs for ERLIN1 Antibody (NBP1-69567)

Learn more about PTMs related to ERLIN1 Antibody (NBP1-69567).

Blogs on ERLIN1

There are no specific blogs for ERLIN1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ERLIN1 Antibody and receive a gift card or discount.


Gene Symbol ERLIN1