ERK4/MAPK4 Antibody (2B10) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related ERK4/MAPK4 Primary Antibodies

Order Details


    • Catalog Number
      H00005596-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERK4/MAPK4 Antibody (2B10) [PerCP] Summary

Immunogen
MAPK4 (NP_002738, 42 a.a. - 151 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK
Specificity
MAPK4 (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERK4/MAPK4 Antibody (2B10) [PerCP]

  • EC 2.7.11
  • EC 2.7.11.24
  • ERK3
  • Erk3-related
  • ERK4
  • ERK-4
  • Extracellular signal-regulated kinase 4
  • MAP kinase 4
  • MAP kinase isoform p63
  • MAPK 4
  • MAPK4
  • mitogen-activated protein kinase 4
  • p63Mapk
  • PRKM4
  • PRKM4p63-MAPK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3196
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87231
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF2848
Species: Hu, Mu
Applications: WB, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
H00005596-M02PCP
Species: Hu
Applications: ELISA, ICC/IF

Publications for ERK4/MAPK4 Antibody (H00005596-M02PCP) (0)

There are no publications for ERK4/MAPK4 Antibody (H00005596-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK4/MAPK4 Antibody (H00005596-M02PCP) (0)

There are no reviews for ERK4/MAPK4 Antibody (H00005596-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ERK4/MAPK4 Antibody (H00005596-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERK4/MAPK4 Products

Bioinformatics Tool for ERK4/MAPK4 Antibody (H00005596-M02PCP)

Discover related pathways, diseases and genes to ERK4/MAPK4 Antibody (H00005596-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERK4/MAPK4 Antibody (H00005596-M02PCP)

Discover more about diseases related to ERK4/MAPK4 Antibody (H00005596-M02PCP).
 

Pathways for ERK4/MAPK4 Antibody (H00005596-M02PCP)

View related products by pathway.

PTMs for ERK4/MAPK4 Antibody (H00005596-M02PCP)

Learn more about PTMs related to ERK4/MAPK4 Antibody (H00005596-M02PCP).
 

Research Areas for ERK4/MAPK4 Antibody (H00005596-M02PCP)

Find related products by research area.

Blogs on ERK4/MAPK4

There are no specific blogs for ERK4/MAPK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERK4/MAPK4 Antibody (2B10) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK4
Entrez