Recombinant Human ERK2 Protein

Product Discontinued

Recombinant Human ERK2 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-360 of Human MAPK1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: MAPK1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERK2 Protein

• EC 2.7.11
• EC 2.7.11.24
• ERK
• ERK2
• ERK-2
• ERK2MAP kinase isoform p42
• ERT1
• Extracellular signal-regulated kinase 2
• MAP kinase 1
• MAP kinase 2
• MAPK 1
• MAPK1
• MAPK2
• mitogen-activated protein kinase 1
• Mitogen-activated protein kinase 2
• p38
• p40
• p41
• p41mapk
• p42mapk
• p42-MAPK
• PRKM1
• PRKM1MAPK 2
• PRKM2
• protein tyrosine kinase ERK2

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for ERK2 Recombinant Protein (H00005594-P01)(1)

Publication using H00005594-P01

• Abeydeera ND, Egli M, Cox N et al. Evoking picomolar binding in RNA by a single phosphorodithioate linkage. Nucleic Acids Res 2016-08-26 [PMID: 27566147]

Bioinformatics

• Gene Symbol: MAPK1