| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 279-379 of Human MAPK3 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | MAPK3 |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Research Areas for ERK1 Partial Recombinant Protein (H00005595-Q01)Find related products by research area.
|
|
Read full blog post. |
|
Read full blog post. |
|
The role of c-Fos in the regulation of the JC virus gene transcription c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B. Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D. Each member of the AP-1 transcri... Read full blog post. |
|
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
|
MAPK3/ERK1 - A signal transduction pathway with roles in development and disease Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAPK3 |