ERG Antibody

Images

 
Western Blot: ERG Antibody [H00002078-A01] - Detection against Immunogen (37.11 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERG Antibody Summary

Immunogen
ERG (NP_891548, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV
Specificity
ERG - v-ets erythroblastosis virus E26 oncogene like (avian)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ERG
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERG Antibody

  • transcriptional regulator ERG
  • 10ets-related
  • erg-3
  • p55
  • TMPRSS2-ERG prostate cancer specific
  • transcriptional regulator ERG
  • Transforming protein ERG
  • v-ets erythroblastosis virus E26 oncogene homolog (avian)
  • v-ets erythroblastosis virus E26 oncogene like (avian)
  • v-ets erythroblastosis virus E26 oncogene like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBL1-12155
Species: Hu
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
H00002078-A01
Species: Hu
Applications: WB, ELISA

Publications for ERG Antibody (H00002078-A01) (0)

There are no publications for ERG Antibody (H00002078-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERG Antibody (H00002078-A01) (0)

There are no reviews for ERG Antibody (H00002078-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERG Antibody (H00002078-A01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody that can IP Erg protein and doesn't cross react with Fli protein.
    • I have spoken to the lab and they have informed me that actually that the antibody (catalog #NBP1-95857) is confirmed not to cross react with Fli1 protein so it should be a viable choice for you in your experiments on Erg.

Secondary Antibodies

 

Isotype Controls

Additional ERG Products

Bioinformatics Tool for ERG Antibody (H00002078-A01)

Discover related pathways, diseases and genes to ERG Antibody (H00002078-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERG Antibody (H00002078-A01)

Discover more about diseases related to ERG Antibody (H00002078-A01).
 

Pathways for ERG Antibody (H00002078-A01)

View related products by pathway.

PTMs for ERG Antibody (H00002078-A01)

Learn more about PTMs related to ERG Antibody (H00002078-A01).
 

Research Areas for ERG Antibody (H00002078-A01)

Find related products by research area.

Blogs on ERG

There are no specific blogs for ERG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERG
Entrez
OMIM
Uniprot