ERF Antibody (3F11) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ERF Primary Antibodies

Order Details


    • Catalog Number
      H00002077-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ERF Antibody (3F11) [DyLight 488] Summary

Immunogen
ERF (AAH22231, 181 a.a. - 290 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG
Specificity
ERF - Ets2 repressor factor (3F11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ERF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERF Antibody (3F11) [DyLight 488]

  • Ets2 repressor factorPE-2PE2ETS domain-containing transcription factor ERF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14951
Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80931
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB

Publications for ERF Antibody (H00002077-M02G) (0)

There are no publications for ERF Antibody (H00002077-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERF Antibody (H00002077-M02G) (0)

There are no reviews for ERF Antibody (H00002077-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ERF Antibody (H00002077-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERF Products

Bioinformatics Tool for ERF Antibody (H00002077-M02G)

Discover related pathways, diseases and genes to ERF Antibody (H00002077-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERF Antibody (H00002077-M02G)

Discover more about diseases related to ERF Antibody (H00002077-M02G).
 

Pathways for ERF Antibody (H00002077-M02G)

View related products by pathway.

PTMs for ERF Antibody (H00002077-M02G)

Learn more about PTMs related to ERF Antibody (H00002077-M02G).
 

Research Areas for ERF Antibody (H00002077-M02G)

Find related products by research area.

Blogs on ERF

There are no specific blogs for ERF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERF Antibody (3F11) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ERF