Erbin Antibody

Images

 
Genetic Strategies: Western Blot: Erbin Antibody [NBP2-13968] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ERBIN antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Erbin Antibody [NBP2-13968] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Erbin Antibody [NBP2-13968] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Erbin Antibody [NBP2-13968] - Staining of human breast shows strong membranous positivity in myoepithelial cells.
Immunohistochemistry-Paraffin: Erbin Antibody [NBP2-13968] - Staining of human gastrointestinal shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Erbin Antibody [NBP2-13968] - Staining of human salivary gland shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Erbin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTA YHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQR
Specificity
Specificity of human Erbin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERBB2IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Erbin Protein (NBP2-13968PEP)
Publications
Read Publication using
NBP2-13968 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Erbin Antibody

  • Densin-180-like protein
  • erbb2 interacting protein
  • Erbb2-interacting proteinErbin
  • ERBB2IP
  • Erbin
  • ERBINLAP2protein LAP2
  • KIAA1225

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-52876
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00008815-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-47403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02211
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
H00008502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Erbin Antibody (NBP2-13968)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Erbin Antibody (NBP2-13968) (0)

There are no reviews for Erbin Antibody (NBP2-13968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Erbin Antibody (NBP2-13968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Erbin Products

Array NBP2-13968

Bioinformatics Tool for Erbin Antibody (NBP2-13968)

Discover related pathways, diseases and genes to Erbin Antibody (NBP2-13968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Erbin Antibody (NBP2-13968)

Discover more about diseases related to Erbin Antibody (NBP2-13968).
 

Pathways for Erbin Antibody (NBP2-13968)

View related products by pathway.

PTMs for Erbin Antibody (NBP2-13968)

Learn more about PTMs related to Erbin Antibody (NBP2-13968).

Blogs on Erbin

There are no specific blogs for Erbin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Erbin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB2IP