ERAS Antibody


Western Blot: ERAS Antibody [NBP1-58322] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ERAS Antibody Summary

Synthetic peptides corresponding to ERAS(ES cell expressed Ras) The peptide sequence was selected from the middle region of ERAS. Peptide sequence AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ERAS and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ERAS Antibody

  • Embryonic stem cell-expressed Ras
  • E-Ras
  • ES cell expressed Ras
  • HRAS2MGC126693
  • HRASPGTPase ERas
  • MGC126691
  • small GTPase protein E-Ras
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene


Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ChIP, ICC

Publications for ERAS Antibody (NBP1-58322) (0)

There are no publications for ERAS Antibody (NBP1-58322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERAS Antibody (NBP1-58322) (0)

There are no reviews for ERAS Antibody (NBP1-58322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERAS Antibody (NBP1-58322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ERAS Products

Bioinformatics Tool for ERAS Antibody (NBP1-58322)

Discover related pathways, diseases and genes to ERAS Antibody (NBP1-58322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERAS Antibody (NBP1-58322)

Discover more about diseases related to ERAS Antibody (NBP1-58322).

Pathways for ERAS Antibody (NBP1-58322)

View related products by pathway.

Research Areas for ERAS Antibody (NBP1-58322)

Find related products by research area.

Blogs on ERAS

There are no specific blogs for ERAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ERAS Antibody and receive a gift card or discount.


Gene Symbol ERAS