ERAS Antibody

Images

 
Western Blot: ERAS Antibody [H00003266-B01P] - Analysis of ERAS expression in transfected 293T cell line by ERAS polyclonal antibody. Lane 1: ERAS transfected lysate(25.63 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERAS Antibody Summary

Immunogen
ERAS (NP_853510.1, 1 a.a. - 233 a.a.) full-length human protein. MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Specificity
ERAS - ES cell expressed Ras,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ERAS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERAS Antibody

  • Embryonic stem cell-expressed Ras
  • E-Ras
  • ES cell expressed Ras
  • HRAS2MGC126693
  • HRASPGTPase ERas
  • MGC126691
  • small GTPase protein E-Ras
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF2485
Species: Hu
Applications: WB, IHC, IP
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-534
Species: Hu
Applications: WB, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF2030
Species: Hu
Applications: WB, IHC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC

Publications for ERAS Antibody (H00003266-B01P) (0)

There are no publications for ERAS Antibody (H00003266-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERAS Antibody (H00003266-B01P) (0)

There are no reviews for ERAS Antibody (H00003266-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERAS Antibody (H00003266-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERAS Products

Bioinformatics Tool for ERAS Antibody (H00003266-B01P)

Discover related pathways, diseases and genes to ERAS Antibody (H00003266-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERAS Antibody (H00003266-B01P)

Discover more about diseases related to ERAS Antibody (H00003266-B01P).
 

Pathways for ERAS Antibody (H00003266-B01P)

View related products by pathway.

Research Areas for ERAS Antibody (H00003266-B01P)

Find related products by research area.

Blogs on ERAS

There are no specific blogs for ERAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAS
Entrez
Uniprot