Epsilon 1 Tubulin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TUBE1. Source: E. coli
Amino Acid Sequence: WNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TUBE1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85204. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Epsilon 1 Tubulin Recombinant Protein Antigen
Background
Microtubules constitute one of the major components of eukaryotic cells cytoskeleton and are involved in many essential processes, including cell division, ciliary and flagellar motility and intracellular transport. Microtubules of the eukaryotic cytoskeleton are composed of a heterodimer of a 223 tubulin. In addition to a 223 tubulin, several other tubulins have been identified, bringing the number of distinct tubulin classes to seven. Most of these tubulins have distinct subcellular localization and an emerging, diverse set of functions. Out of the seven different tubulins, four new members of the tubulin family have been identified including epsilon tubulin. Epsilon tubulin was found to be located in the centriolar area, a localization that is dependent on cell cycle modulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: AC
Publications for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)
There are no publications for Epsilon 1 Tubulin Protein (NBP1-85204PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)
There are no reviews for Epsilon 1 Tubulin Protein (NBP1-85204PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)
Additional Epsilon 1 Tubulin Products
Research Areas for Epsilon 1 Tubulin Protein (NBP1-85204PEP)
Find related products by research area.
|
Blogs on Epsilon 1 Tubulin