Epsilon 1 Tubulin Recombinant Protein Antigen

Images

 
There are currently no images for Epsilon 1 Tubulin Protein (NBP1-85204PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Epsilon 1 Tubulin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TUBE1.

Source: E. coli

Amino Acid Sequence: WNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TUBE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85204.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Epsilon 1 Tubulin Recombinant Protein Antigen

  • dJ142L7.2
  • Epsilon 1 Tubulin
  • Epsilon-tubulin
  • FLJ22589
  • FLJ44203
  • TUBE
  • TUBE1
  • TUBEepsilon-tubulin
  • tubulin epsilon chain
  • tubulin, epsilon 1

Background

Microtubules constitute one of the major components of eukaryotic cells cytoskeleton and are involved in many essential processes, including cell division, ciliary and flagellar motility and intracellular transport. Microtubules of the eukaryotic cytoskeleton are composed of a heterodimer of a 223 tubulin. In addition to a 223 tubulin, several other tubulins have been identified, bringing the number of distinct tubulin classes to seven. Most of these tubulins have distinct subcellular localization and an emerging, diverse set of functions. Out of the seven different tubulins, four new members of the tubulin family have been identified including epsilon tubulin. Epsilon tubulin was found to be located in the centriolar area, a localization that is dependent on cell cycle modulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77068
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
AF2699
Species: Mu
Applications: Simple Western, WB
NBP1-87390
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-88502
Species: Hu
Applications: IHC,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF226
Species: Hu
Applications: WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-32652
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00004082-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-48144
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-85204PEP
Species: Hu
Applications: AC

Publications for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)

There are no publications for Epsilon 1 Tubulin Protein (NBP1-85204PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)

There are no reviews for Epsilon 1 Tubulin Protein (NBP1-85204PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Epsilon 1 Tubulin Protein (NBP1-85204PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Epsilon 1 Tubulin Products

Research Areas for Epsilon 1 Tubulin Protein (NBP1-85204PEP)

Find related products by research area.

Blogs on Epsilon 1 Tubulin

There are no specific blogs for Epsilon 1 Tubulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Epsilon 1 Tubulin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBE1