Epsilon 1 Tubulin Antibody - BSA Free

Western Blot: Epsilon 1 Tubulin Antibody [NBP1-58223] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Immunohistochemistry-Paraffin: Epsilon 1 Tubulin Antibody [NBP1-58223] - Drosophila Melanogaster whole-mount brains tissue at an antibody concentration of 5 ug/ml.

• Reactivity: Hu, Dr
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Epsilon 1 Tubulin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUBE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Epsilon 1 Tubulin Antibody - BSA Free

• dJ142L7.2
• Epsilon 1 Tubulin
• Epsilon-tubulin
• FLJ22589
• FLJ44203
• TUBE
• TUBE1
• TUBEepsilon-tubulin
• tubulin epsilon chain
• tubulin, epsilon 1

Background

This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUBE1
• Uniprot:
  • Q9UJT0(Human)