Recombinant Human EphB3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related EphB3 Peptides and Proteins

Order Details


    • Catalog Number
      H00002049-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human EphB3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-99 of Human EPHB3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EPHB3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EphB3 Protein

  • Cek10
  • EC 2.7.10
  • EC 2.7.10.1
  • EK2
  • EPH receptor B3
  • EphB3
  • EPH-like kinase 2
  • EPH-like tyrosine kinase-2
  • ephrin type-B receptor 3
  • ETK2Hek2
  • Hek2
  • human embryo kinase 2
  • Mdk5
  • Sek4
  • Tyro6
  • Tyrosine-protein kinase TYRO6

Background

EPHB3 - EPH receptor B3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF395
Species: Hu
Applications: WB, IHC
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF641
Species: Mu
Applications: WB, IHC
640-A3
Species: Mu
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF2567
Species: Mu
Applications: WB, IHC
NB100-93290
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for EphB3 Partial Recombinant Protein (H00002049-Q01) (0)

There are no publications for EphB3 Partial Recombinant Protein (H00002049-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphB3 Partial Recombinant Protein (H00002049-Q01) (0)

There are no reviews for EphB3 Partial Recombinant Protein (H00002049-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphB3 Partial Recombinant Protein (H00002049-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EphB3 Products

Bioinformatics Tool for EphB3 Partial Recombinant Protein (H00002049-Q01)

Discover related pathways, diseases and genes to EphB3 Partial Recombinant Protein (H00002049-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphB3 Partial Recombinant Protein (H00002049-Q01)

Discover more about diseases related to EphB3 Partial Recombinant Protein (H00002049-Q01).
 

Pathways for EphB3 Partial Recombinant Protein (H00002049-Q01)

View related products by pathway.

PTMs for EphB3 Partial Recombinant Protein (H00002049-Q01)

Learn more about PTMs related to EphB3 Partial Recombinant Protein (H00002049-Q01).
 

Research Areas for EphB3 Partial Recombinant Protein (H00002049-Q01)

Find related products by research area.

Blogs on EphB3

There are no specific blogs for EphB3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EphB3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHB3
Entrez