EphA2 Antibody (1E3.) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related EphA2 Primary Antibodies

Order Details


    • Catalog Number
      H00001969-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EphA2 Antibody (1E3.) [PerCP] Summary

Immunogen
EPHA2 (AAH37166 204 a.a. - 326 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
Specificity
EPHA2 - EPH receptor A2 (1E3)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPHA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EphA2 Antibody (1E3.) [PerCP]

  • ARCC2
  • EC 2.7.10
  • EC 2.7.10.1
  • Eck
  • ECKepithelial cell receptor protein tyrosine kinase
  • EPH receptor A2
  • EphA2
  • ephrin type-A receptor 2
  • Epithelial cell kinase
  • Myk2
  • Sek2
  • soluble EPHA2 variant 1
  • Tyrosine-protein kinase receptor ECK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF603
Species: Mu
Applications: WB, Block, ICC
AF641
Species: Mu
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu

Publications for EphA2 Antibody (H00001969-M02PCP) (0)

There are no publications for EphA2 Antibody (H00001969-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA2 Antibody (H00001969-M02PCP) (0)

There are no reviews for EphA2 Antibody (H00001969-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EphA2 Antibody (H00001969-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EphA2 Products

Bioinformatics Tool for EphA2 Antibody (H00001969-M02PCP)

Discover related pathways, diseases and genes to EphA2 Antibody (H00001969-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA2 Antibody (H00001969-M02PCP)

Discover more about diseases related to EphA2 Antibody (H00001969-M02PCP).
 

Pathways for EphA2 Antibody (H00001969-M02PCP)

View related products by pathway.

PTMs for EphA2 Antibody (H00001969-M02PCP)

Learn more about PTMs related to EphA2 Antibody (H00001969-M02PCP).
 

Research Areas for EphA2 Antibody (H00001969-M02PCP)

Find related products by research area.

Blogs on EphA2

There are no specific blogs for EphA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EphA2 Antibody (1E3.) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA2
Entrez