Recombinant Human EphA1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related EphA1 Peptides and Proteins

Order Details


    • Catalog Number
      H00002041-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human EphA1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-107 of Human EPHA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EPHA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EphA1 Protein

  • EC 2.7.10
  • EC 2.7.10.1
  • EPH receptor A1
  • eph tyrosine kinase 1
  • EphA1
  • EPHephrin type-A receptor 1
  • EPHT
  • EPHT1erythropoietin-producing hepatoma amplified sequence
  • Esk
  • MGC163163
  • oncogene EPH
  • soluble EPHA1 variant 1
  • soluble EPHA1 variant 2
  • Tyrosine-protein kinase receptor EPH

Background

EPHA1 - EPH receptor A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF641
Species: Mu
Applications: WB, IHC
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF603
Species: Mu
Applications: WB, Block, ICC
374-EA
Species: Hu
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
640-A3
Species: Mu
AF432
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF395
Species: Hu
Applications: WB, IHC
359-EA
Species: Hu
MAB541
Species: Hu, Rt
Applications: WB, Flow, CyTOF-ready, ICC
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF369
Species: Hu
Applications: WB, IHC, ICC
H00002041-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EphA1 Partial Recombinant Protein (H00002041-Q01) (0)

There are no publications for EphA1 Partial Recombinant Protein (H00002041-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EphA1 Partial Recombinant Protein (H00002041-Q01) (0)

There are no reviews for EphA1 Partial Recombinant Protein (H00002041-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EphA1 Partial Recombinant Protein (H00002041-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EphA1 Products

Bioinformatics Tool for EphA1 Partial Recombinant Protein (H00002041-Q01)

Discover related pathways, diseases and genes to EphA1 Partial Recombinant Protein (H00002041-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EphA1 Partial Recombinant Protein (H00002041-Q01)

Discover more about diseases related to EphA1 Partial Recombinant Protein (H00002041-Q01).
 

Pathways for EphA1 Partial Recombinant Protein (H00002041-Q01)

View related products by pathway.

PTMs for EphA1 Partial Recombinant Protein (H00002041-Q01)

Learn more about PTMs related to EphA1 Partial Recombinant Protein (H00002041-Q01).
 

Research Areas for EphA1 Partial Recombinant Protein (H00002041-Q01)

Find related products by research area.

Blogs on EphA1

There are no specific blogs for EphA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EphA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHA1
Entrez